PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G35515.1
Common NameHOS10, MYB8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 212aa    MW: 24238.5 Da    PI: 8.8994
Description high response to osmotic stress 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G35515.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++ +g+ R++k+c++rw +yl
      AT1G35515.1 14 KGAWTKEEDQRLIDYIRNHGEGSWRSLPKSVGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.62.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T  E++++v+++ ++G++ W++Ia +++ gRt++++k++w+++
      AT1G35515.1  67 RGNFTDGEEQIIVKLHSLFGNK-WSLIAGKLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.033961IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002495.0E-171461IPR001005SANT/Myb domain
CDDcd001673.26E-111661No hitNo description
PROSITE profilePS5129426.62362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002493.2E-1467111IPR001005SANT/Myb domain
CDDcd001671.67E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009651Biological Processresponse to salt stress
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000191anatomysynergid
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRSPCCEKA HMNKGAWTKE EDQRLIDYIR NHGEGSWRSL PKSVGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDGEEQIIVK LHSLFGNKWS LIAGKLPGRT DNEIKNYWNT HIKRKLLNRG  120
IDPKTHGSII EPKTTSFHPR NEDLKSTFPG SVKLKMETSC ENCASTSGTT TDEDLRLSVD  180
CDYRYDHLDK ELNLDLTLGY SPTRFVGVGS CY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.728251e-147bud| flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262027_at0.0
Expression AtlasAT1G35515-
AtGenExpressAT1G35515-
ATTED-IIAT1G35515-
Functional Description ? help Back to Top
Source Description
TAIREncodes a nuclear localized R2R3-type MYB transcription factor that is involved in responses to abiotic stress including cold acclimation,osmotic and salt stress.Mutants are sensitive to salt, freezing and osmotic stress.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G35515.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G77120(R), AT2G39030(A), AT2G42540(R), AT5G15960(R), AT5G52310(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G35515
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2079910.0AF207991.1 Arabidopsis thaliana putative transcription factor (MYB8) mRNA, complete cds.
GenBankAY5195610.0AY519561.1 Arabidopsis thaliana MYB transcription factor (At1g35515) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849749.11e-157R2R3-type MYB transcription factor
SwissprotQ388511e-105MYB6_ARATH; Transcription repressor MYB6
TrEMBLQ9SDS81e-157Q9SDS8_ARATH; MYB transcription factor
STRINGAT1G35515.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  2. Zhu J, et al.
    HOS10 encodes an R2R3-type MYB transcription factor essential for cold acclimation in plants.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(28): p. 9966-71
    [PMID:15994234]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Nilson SE,Assmann SM
    The control of transpiration. Insights from Arabidopsis.
    Plant Physiol., 2007. 143(1): p. 19-27
    [PMID:17210910]
  5. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  6. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]